Protein Info for B158DRAFT_0701 in Kangiella aquimarina DSM 16071

Annotation: NTP pyrophosphohydrolases including oxidative damage repair enzymes

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00293: NUDIX
  • amino acids 43 to 156 (114 residues), 61.1 bits, E=6e-21

Best Hits

Swiss-Prot: 52% identical to NUDE_ECOLI: ADP compounds hydrolase NudE (nudE) from Escherichia coli (strain K12)

KEGG orthology group: K08312, ADP-ribose diphosphatase [EC: 3.6.1.-] (inferred from 88% identity to kko:Kkor_2304)

MetaCyc: 52% identical to ADP-sugar diphosphatase NudE (Escherichia coli K-12 substr. MG1655)
ADP-sugar diphosphatase. [EC: 3.6.1.21]

Predicted SEED Role

"ADP compounds hydrolase NudE (EC 3.6.1.-)" in subsystem Nudix proteins (nucleoside triphosphate hydrolases) (EC 3.6.1.-)

KEGG Metabolic Maps

• Folate biosynthesis
• Fructose and mannose metabolism
• Lipopolysaccharide biosynthesis
• Purine metabolism
• Starch and sucrose metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.6.1.- or 3.6.1.21

Protein Sequence (182 amino acids)

>B158DRAFT_0701 NTP pyrophosphohydrolases including oxidative damage repair enzymes (Kangiella aquimarina DSM 16071)
MRKPPKIKNTKLIAQTRIFGVEEMELEFSNGVYRIYERLKAGKHGAVMIVPLLDSETMLL
IKEYAAGVERYELAFPKGLIDAGETSEQAANRELQEEVGYAAEQLHVLRKVSLAPGYLGH
QMDIVVAEELFPSKLEGDEPEPIEVVEWKISDMDSLLDIEEFSEARSIAALYLLKDYLAK
KQ