Protein Info for B158DRAFT_0638 in Kangiella aquimarina DSM 16071

Annotation: Outer membrane protein and related peptidoglycan-associated (lipo)proteins

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 377 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF13505: OMP_b-brl" amino acids 7 to 177 (171 residues), 38.7 bits, see alignment E=1.8e-13 PF02412: TSP_3" amino acids 196 to 214 (19 residues), 16.5 bits, see alignment (E = 8.6e-07) amino acids 224 to 244 (21 residues), 18.8 bits, see alignment (E = 1.6e-07) PF00691: OmpA" amino acids 270 to 365 (96 residues), 87.9 bits, see alignment E=7.5e-29

Best Hits

KEGG orthology group: K03286, OmpA-OmpF porin, OOP family (inferred from 89% identity to kko:Kkor_2364)

Predicted SEED Role

"Outer membrane protein A precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (377 amino acids)

>B158DRAFT_0638 Outer membrane protein and related peptidoglycan-associated (lipo)proteins (Kangiella aquimarina DSM 16071)
MKKKLLTAACLLALGSTAFASEEVQDRHGFYGHVGLYGLELDSYWDSDRTLSGGLGLGWF
FNKNVALEVEYNYFDEISNNAINADTDIENTALNLLLNDTSWIGSTTTYPFLKVGYGELS
DKYGVYGSDLEDGYYKVGVGVQHFATDNVYLRAGLDLLDSGDLGDHKVWYLSYGYFFGDT
VKSGTAPAPKPVEKAKDSDGDGVLDANDQCPGTPAGAAVDANGCPLDSDNDGVYDYQDAC
PGTAPGVQVDEKGCEVKVAEEVVVDMRLNFDTNKYEIKPEMVAEIAKVAEFLRQYPDVNA
EIQGHTDSVGSSAYNQGLSERRANSVKDYLVSNFGIDASRLTAKGYGEEQPIADNSTEEG
RALNRRAEAHAETMTTK