Protein Info for B158DRAFT_0557 in Kangiella aquimarina DSM 16071

Annotation: Dihydrofolate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00186: DHFR_1
  • amino acids 6 to 167 (162 residues), 211.8 bits, E=2.3e-67

Best Hits

Swiss-Prot: 54% identical to DYR3_SALTM: Dihydrofolate reductase type 3 (dhfrIII) from Salmonella typhimurium

KEGG orthology group: K00287, dihydrofolate reductase [EC: 1.5.1.3] (inferred from 92% identity to kko:Kkor_2415)

Predicted SEED Role

"Dihydrofolate reductase (EC 1.5.1.3)" in subsystem Folate Biosynthesis (EC 1.5.1.3)

MetaCyc Pathways

• folate transformations III (E. coli) (8/9 steps found)
• superpathway of tetrahydrofolate biosynthesis and salvage (10/12 steps found)
• folate transformations II (plants) (9/11 steps found)
• dTMP de novo biosynthesis (mitochondrial) (3/3 steps found)
• tetrahydrofolate biosynthesis I (3/3 steps found)
• superpathway of tetrahydrofolate biosynthesis (8/10 steps found)
• superpathway of chorismate metabolism (41/59 steps found)

KEGG Metabolic Maps

• Biosynthesis of phenylpropanoids
• Folate biosynthesis
• One carbon pool by folate

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.5.1.3

Protein Sequence (170 amino acids)

>B158DRAFT_0557 Dihydrofolate reductase (Kangiella aquimarina DSM 16071)
MSKPIISLIVAMANERVIGKDNQMPWHLPADLKHFKAVTLGKPVIMGRKTHESIGMVLPG
RDNIIISRNPDYRSEFHNERCQVVTSLEEAFAAAGDAQEVMIIGGSNIYHQMIDHADKLY
LTFIDLDTEGDAHFPDWTHLQWQEVSREKHQPDEKNPYHYQFVELARIRD