Protein Info for B158DRAFT_0486 in Kangiella aquimarina DSM 16071

Annotation: iron-sulfur cluster binding protein, putative

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 TIGR00276: epoxyqueuosine reductase" amino acids 18 to 351 (334 residues), 463.9 bits, see alignment E=1.4e-143 PF08331: QueG_DUF1730" amino acids 63 to 144 (82 residues), 68 bits, see alignment E=5.6e-23 PF13484: Fer4_16" amino acids 197 to 260 (64 residues), 73 bits, see alignment E=2.7e-24

Best Hits

Swiss-Prot: 54% identical to QUEG_ALIF1: Epoxyqueuosine reductase (queG) from Aliivibrio fischeri (strain ATCC 700601 / ES114)

KEGG orthology group: None (inferred from 84% identity to kko:Kkor_2517)

MetaCyc: 52% identical to epoxyqueuosine reductase (Escherichia coli K-12 substr. MG1655)
RXN-12104 [EC: 1.17.99.6]

Predicted SEED Role

"Iron-sulfur cluster-binding protein"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.17.99.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (382 amino acids)

>B158DRAFT_0486 iron-sulfur cluster binding protein, putative (Kangiella aquimarina DSM 16071)
MPLTDQQLEQIKQTAVRLAKEHGFQDLRVSDTDTGGYFERFKQWVDDGYHGCMSFLERNQ
ELRQNPAELHPNTCRVLSLRFDYLNNNASFTTPLKDKSLANISRYALGRDYHKLMRKRLQ
RVIEDLRSTLEKDCDIDYRVLVDSAPVLETAFAEKSGLGWKGKHTLILNKDAGSWFFLGE
IFINLPLSIDEPVEDLCGSCSSCINLCPTDAIIDDKKIDARRCISYLTIENQEAIPIELR
PLMGNRIYGCDDCQLACPYNRFANHTNIEDFSARHDLHKVSLATLWSWDEPTFLNNFQGS
PIRRIGYQNWLRNLAVAIGNSNQHEMIEPLKAKYEEANEMVREHIDWAVQQLTNPENIDR
TATDKKTQKLIHCVTVMLPDDA