Protein Info for B158DRAFT_0467 in Kangiella aquimarina DSM 16071

Annotation: haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01662: HAD hydrolase, family IIIA
  • amino acids 10 to 152 (143 residues), 110.1 bits, E=1.4e-35
• TIGR01656: histidinol-phosphate phosphatase domain
  • amino acids 11 to 149 (139 residues), 120.1 bits, E=1.1e-38
• PF08645: PNK3P
  • amino acids 14 to 136 (123 residues), 35.5 bits, E=1.7e-12
• PF00702: Hydrolase
  • amino acids 23 to 145 (123 residues), 37.6 bits, E=6.4e-13
• TIGR01549: HAD hydrolase, family IA, variant 1
  • amino acids 103 to 145 (43 residues), 26.5 bits, 1.1e-09
• PF13242: Hydrolase_like
  • amino acids 106 to 159 (54 residues), 50.4 bits, E=3.4e-17
• PF13419: HAD_2
  • amino acids 106 to 149 (44 residues), 34 bits, E=6.6e-12

Best Hits

Swiss-Prot: 49% identical to GMHBB_PSEPK: D-glycero-beta-D-manno-heptose-1,7-bisphosphate 7-phosphatase (gmhB) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K03273, D-glycero-D-manno-heptose 1,7-bisphosphate phosphatase [EC: 3.1.3.-] (inferred from 90% identity to kko:Kkor_2540)

Predicted SEED Role

"Histidinol-phosphatase (EC 3.1.3.15)" in subsystem Histidine Biosynthesis (EC 3.1.3.15)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• L-histidine biosynthesis (8/10 steps found)

KEGG Metabolic Maps

• Aminosugars metabolism
• Ascorbate and aldarate metabolism
• Biosynthesis of alkaloids derived from histidine and purine
• Ether lipid metabolism
• Fructose and mannose metabolism
• Histidine metabolism
• Lipopolysaccharide biosynthesis
• Nicotinate and nicotinamide metabolism
• Riboflavin metabolism
• Sphingolipid metabolism
• Thiamine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.-

Use Curated BLAST to search for 3.1.3.- or 3.1.3.15

Protein Sequence (182 amino acids)

>B158DRAFT_0467 haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E (Kangiella aquimarina DSM 16071)
MSKIDWDKIKVIVLDRDGVINHDSDEYIKSPEEWIPIAGSLPAIAKLNQRFKVAIATNQS
GIARGFYDEPILHAMHDKMDALLKEYDGHIDHIEYCPHHPDDGCSCRKPETRMLEHIAAK
FSANPQEIVFVGDSSSDYQCAQNFGCPFVLLLTGKGLKTLNKLAGKDLLVEKSLAMLVES
ID