Protein Info for B158DRAFT_0281 in Kangiella aquimarina DSM 16071

Annotation: Rhodanese-related sulfurtransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00581: Rhodanese
  • amino acids 9 to 97 (89 residues), 76.7 bits, E=8.3e-26

Best Hits

Swiss-Prot: 53% identical to GLPE_PSEU2: Thiosulfate sulfurtransferase GlpE (glpE) from Pseudomonas syringae pv. syringae (strain B728a)

KEGG orthology group: K02439, thiosulfate sulfurtransferase [EC: 2.8.1.1] (inferred from 93% identity to kko:Kkor_0138)

MetaCyc: 48% identical to thiosulfate sulfurtransferase GlpE (Escherichia coli K-12 substr. MG1655)
Thiosulfate sulfurtransferase. [EC: 2.8.1.1]; 2.8.1.- [EC: 2.8.1.1]

Predicted SEED Role

"Thiosulfate sulfurtransferase GlpE (EC 2.8.1.1)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (EC 2.8.1.1)

MetaCyc Pathways

• thiosulfate disproportionation IV (rhodanese) (1/1 steps found)
• sulfide oxidation IV (mitochondria) (2/5 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.1

Protein Sequence (104 amino acids)

>B158DRAFT_0281 Rhodanese-related sulfurtransferase (Kangiella aquimarina DSM 16071)
MTQFKRISIEDTKQLMQDKDVMLADIRDPQSFAAGHMPNSKNINNQNAAEFIEQSDKDKP
LVVVCYHGNSSQPAAQYFAAHGFKEVYSMDGGFELWKLNNPVEK