Protein Info for B158DRAFT_0204 in Kangiella aquimarina DSM 16071

Annotation: Di- and tricarboxylate transporters

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 609 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 32 to 52 (21 residues), see Phobius details amino acids 67 to 87 (21 residues), see Phobius details amino acids 102 to 122 (21 residues), see Phobius details amino acids 124 to 124 (1 residues), see Phobius details amino acids 128 to 145 (18 residues), see Phobius details amino acids 154 to 178 (25 residues), see Phobius details amino acids 193 to 213 (21 residues), see Phobius details amino acids 421 to 451 (31 residues), see Phobius details amino acids 464 to 483 (20 residues), see Phobius details amino acids 495 to 518 (24 residues), see Phobius details amino acids 549 to 567 (19 residues), see Phobius details amino acids 587 to 607 (21 residues), see Phobius details PF03600: CitMHS" amino acids 35 to 539 (505 residues), 218.7 bits, see alignment E=1.2e-68 PF02080: TrkA_C" amino acids 238 to 303 (66 residues), 33.3 bits, see alignment E=3.6e-12 amino acids 327 to 398 (72 residues), 45.2 bits, see alignment E=7.2e-16

Best Hits

KEGG orthology group: None (inferred from 94% identity to kko:Kkor_0209)

Predicted SEED Role

"TrkA-C domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (609 amino acids)

>B158DRAFT_0204 Di- and tricarboxylate transporters (Kangiella aquimarina DSM 16071)
MPFPDLPNNHALFVLLLTVFALYLFRRDDIPLETSCVIVLLALTIGFSFAPFHNFNGRLE
PMQFFSGFGHEALVAVCALMICGQGLVRTGALEPIGRFLGSIWKSAPLFSLLLTLLIAGA
LSAFVNNTPIVVLLLPILVSVAIRTKTSPSALLMPMGFATIIGGMATTIGTSTNLLVVSV
ASDLGLPDFGMFDFLVPASIAAIVAIIYLWLIAPRILPERHAVMKNTSPRVFTAQLHIEK
GSFADGKTLSEVINKTDGQMKVVRIQRGEEISIVPMPDAKVKAGDRLRVIDTPEHLKEYE
QVLGAKLYRRGKQISEDHPLTAENQQLSEIVVTPGSPLAGRTLKDVEFIDQYGLVAIALH
RGDSVVDMHNKGLGTVTLHVGDVLLVQGGQKDIAEFKKSGEILILDATTDLPKSHRAPRA
LFIMGMVVLLAAIGALPIAISALGGAMLMILVHCMTWREAMHALSAQVILIVASSLALGI
AMIETGAAEYLAQAFVSSLYGAPPALLLSGLMLLLALLTNVVSNNAAAVIGTPIAVSIAN
QLNLPAEPFVIAVLFGANMSFATPMAYKTNLLVMSAGGYKFSDFIKVGVPLVILMWITLS
IVLPILYQF