Protein Info for B158DRAFT_0176 in Kangiella aquimarina DSM 16071

Annotation: Kef-type K+ transport systems, predicted NAD-binding component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 transmembrane" amino acids 41 to 63 (23 residues), see Phobius details amino acids 69 to 91 (23 residues), see Phobius details amino acids 103 to 122 (20 residues), see Phobius details amino acids 128 to 146 (19 residues), see Phobius details amino acids 167 to 186 (20 residues), see Phobius details amino acids 224 to 246 (23 residues), see Phobius details PF00520: Ion_trans" amino acids 38 to 245 (208 residues), 123.5 bits, see alignment E=8.4e-40 PF07885: Ion_trans_2" amino acids 172 to 244 (73 residues), 59.5 bits, see alignment E=2.4e-20

Best Hits

KEGG orthology group: None (inferred from 94% identity to kko:Kkor_0238)

Predicted SEED Role

"Potassium voltage-gated channel subfamily KQT; possible potassium channel, VIC family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (285 amino acids)

>B158DRAFT_0176 Kef-type K+ transport systems, predicted NAD-binding component (Kangiella aquimarina DSM 16071)
MTPEFKYRKHKFDEGEPLSPWREKIHEVIFEADTFAGKTFDVALIITIFLSVLAVMLDSV
QVISVQYGSMLFAAEWAFTILFTIEYILRLISVRKPMLYAKSFYGVVDLLSILPTYLTLI
IVDAKYFLVIRILRVLRIFRIFKLANYMGEASMMMNALRNSRAKISVFLYTVLMSVVVFG
SLVYVIEGPENGFSSIPKSVYWAIVTLTTVGYGDISPQTPVGQFLASCIMILGYGLIAVP
TGIYSAEITREAMKKKDVTNNACPSCAYEGHDKDAEFCKKCGAKL