Protein Info for B158DRAFT_0165 in Kangiella aquimarina DSM 16071

Annotation: Factor for inversion stimulation Fis, transcriptional activator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 101 PF27465: Fis_N" amino acids 15 to 49 (35 residues), 29.7 bits, see alignment E=7e-11 PF02954: HTH_8" amino acids 58 to 98 (41 residues), 50.5 bits, see alignment E=1.4e-17

Best Hits

Swiss-Prot: 51% identical to FIS_PASMU: DNA-binding protein Fis (fis) from Pasteurella multocida (strain Pm70)

KEGG orthology group: K03557, Fis family transcriptional regulator, factor for inversion stimulation protein (inferred from 100% identity to kko:Kkor_0249)

Predicted SEED Role

"DNA-binding protein Fis" in subsystem DNA structural proteins, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (101 amino acids)

>B158DRAFT_0165 Factor for inversion stimulation Fis, transcriptional activator (Kangiella aquimarina DSM 16071)
MTIFDTNLTRESNNQDNPVDGNSFASNPTLREHVAMSMQNYLKQMHGQPLSEVYDLVLTQ
VEEPLLRAIMDYTRNNQTKAAQVLGLNRGTLRKKLKRYNLL