Protein Info for B158DRAFT_0153 in Kangiella aquimarina DSM 16071

Annotation: Thiol:disulfide interchange protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 641 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 209 to 236 (28 residues), see Phobius details amino acids 249 to 273 (25 residues), see Phobius details amino acids 285 to 307 (23 residues), see Phobius details amino acids 328 to 358 (31 residues), see Phobius details amino acids 364 to 387 (24 residues), see Phobius details amino acids 399 to 419 (21 residues), see Phobius details amino acids 425 to 444 (20 residues), see Phobius details amino acids 456 to 476 (21 residues), see Phobius details PF11412: DsbD_N" amino acids 44 to 154 (111 residues), 100 bits, see alignment E=2.9e-32 PF13386: DsbD_2" amino acids 213 to 413 (201 residues), 25.4 bits, see alignment E=3.6e-09 PF02683: DsbD" amino acids 214 to 419 (206 residues), 60.2 bits, see alignment E=8.2e-20 PF13899: Thioredoxin_7" amino acids 530 to 611 (82 residues), 50.4 bits, see alignment E=6.2e-17 PF13098: Thioredoxin_2" amino acids 540 to 627 (88 residues), 31.2 bits, see alignment E=7e-11

Best Hits

KEGG orthology group: K04084, thiol:disulfide interchange protein DsbD [EC: 1.8.1.8] (inferred from 86% identity to kko:Kkor_0260)

Predicted SEED Role

"Cytochrome c-type biogenesis protein DsbD, protein-disulfide reductase (EC 1.8.1.8)" in subsystem Biogenesis of c-type cytochromes or Periplasmic disulfide interchange (EC 1.8.1.8)

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.8

Use Curated BLAST to search for 1.8.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (641 amino acids)

>B158DRAFT_0153 Thiol:disulfide interchange protein (Kangiella aquimarina DSM 16071)
MKIGIKTSIHSFLLALFSFIALGLSSNSSQAAQIDLNSLLGEEEELLKVDDAFVLQAEIL
DNTVLVKFEIADGYYMYRERFGFKSDNATLGEPLIPDGKEKDDPYLGQTEVYYHFIEIAV
PYSNATNPLTLSIDFQGCAEDRLCYPPTTREVTLEVPASTLALANSGTASINSDAKDAAT
ASKDGKEAFVSEQQSLMEDLEEKGVFWNFFKFILIGLGLTFTPCVFPMIPIISGIIAGQG
KDLTTRKAFGLALSYTQAMAIVYTIFGVLVALAGQSLSGYLQSPGFVIGAAIVFVLLSLS
MFGFYELQLPSSLQAKLAEKSNSQKTGSYIGSAIMGAISALIVSPCVTVPLIAILLIIAQ
TGDILLGAVSLYGLGIGMGIPLIIIAVTEGRFLPKAGNWMNAIKAAFGVAMLAVALYLIK
HLLPNSIYMYGWSLLALIPGYYLFKNQLPNVGWRNLFAGLGLVLMIYGALLVIGGAQGNR
NLLQPLGQSYSMMTTEYSQMAEGPAQMKPQGTLTDSSKPHLQFERIKTLSQLEQRVAEAN
AQGKTVMVDFFAVWCAACYEFEALVFTDPAVHAALGNTVLLQADVTANDPQDIQLMNAFN
ILGLPSILFFDLEGNELTQYRANGFEEADVFVRRIEAAFGL