Protein Info for B158DRAFT_0144 in Kangiella aquimarina DSM 16071

Annotation: Carbonic anhydrase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00484: Pro_CA
  • amino acids 37 to 188 (152 residues), 188.6 bits, E=4.5e-60

Best Hits

Swiss-Prot: 52% identical to CAN_EMENI: Carbonic anhydrase (AN1805) from Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)

KEGG orthology group: K01673, carbonic anhydrase [EC: 4.2.1.1] (inferred from 77% identity to kko:Kkor_0271)

Predicted SEED Role

"Carbonic anhydrase (EC 4.2.1.1)" in subsystem Carboxysome or Cyanate hydrolysis (EC 4.2.1.1)

MetaCyc Pathways

• cyanate degradation (2/3 steps found)
• CO₂ fixation into oxaloacetate (anaplerotic) (1/2 steps found)
• C4 photosynthetic carbon assimilation cycle, NADP-ME type (3/7 steps found)
• C4 photosynthetic carbon assimilation cycle, NAD-ME type (5/11 steps found)
• 3-hydroxypropanoate cycle (6/13 steps found)
• glyoxylate assimilation (6/13 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (9/18 steps found)
• C4 photosynthetic carbon assimilation cycle, PEPCK type (6/14 steps found)
• superpathway of the 3-hydroxypropanoate cycle (7/18 steps found)
• gluconeogenesis II (Methanobacterium thermoautotrophicum) (6/18 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (16/56 steps found)

KEGG Metabolic Maps

• Nitrogen metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.1

Protein Sequence (210 amino acids)

>B158DRAFT_0144 Carbonic anhydrase (Kangiella aquimarina DSM 16071)
MEGIKKLFKNNKAWAEQAERNSPGYFKILSEQQSPRYLWIGCSDSRVPANQITGLMPGEV
FVHRNVANIVSNSDLNCLSVIQYAVEVLKVRHIVVCGHYGCGGVNVALSNRKHGLIDNWL
SNIKEIYLKHEPEFKLIKNEEERSNLLCELNVIEQVGNVCRTTVVQDAWSRDQALSVHGW
CYSLNNGLLKDLKVSVSSKKQVPEIFNYHE