Protein Info for B158DRAFT_0122 in Kangiella aquimarina DSM 16071

Annotation: NADH-quinone oxidoreductase, F subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01959: NADH oxidoreductase (quinone), F subunit
  • amino acids 7 to 414 (408 residues), 648.6 bits, E=1.4e-199
• PF01512: Complex1_51K
  • amino acids 50 to 218 (169 residues), 151.9 bits, E=2e-48
• PF10531: SLBB
  • amino acids 242 to 290 (49 residues), 48.2 bits, 1.2e-16
• PF10589: NADH_4Fe-4S
  • amino acids 330 to 412 (83 residues), 116.4 bits, E=6.2e-38

Best Hits

Swiss-Prot: 57% identical to NUOF_RICBR: NADH-quinone oxidoreductase subunit F (nuoF) from Rickettsia bellii (strain RML369-C)

KEGG orthology group: K00335, NADH dehydrogenase I subunit F [EC: 1.6.5.3] (inferred from 96% identity to kko:Kkor_0294)

MetaCyc: 53% identical to NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial (Homo sapiens)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain F (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

• aerobic respiration III (alternative oxidase pathway) (3/3 steps found)
• aerobic respiration I (cytochrome c) (3/4 steps found)
• NADH to cytochrome bd oxidase electron transfer I (1/2 steps found)
• NADH to cytochrome bo oxidase electron transfer I (1/2 steps found)
• Fe(II) oxidation (3/6 steps found)
• NAD(P)/NADPH interconversion (2/6 steps found)

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Protein Sequence (431 amino acids)

>B158DRAFT_0122 NADH-quinone oxidoreductase, F subunit (Kangiella aquimarina DSM 16071)
MANEVCFRTLHLDKPWTLKTYESAGGYRMWRKILAEKTPPEEIIEELKLSALRGRGGAGF
PTGLKWSFMPRHAPGQKYVVCNSDEGEPGTFKDRDILRFNPHQLIEGMAIGGYVMGATVG
YNYMRGEFYEPIERFEQALEEAYKEGLLGKDILGSGVDFDLHSHIGAGAYICGEETALLE
SLEGKKGQPRFKPPFPANYGLFGRPTNVNNTESFASVPVILEKGGKWFLELGKENNGGTK
IFSVSGHVNKPGNYEIGLGTPFKDLLEMAGGMKDGKKLKAVIPGGSSAPVLPADVMMDIT
MDYDAIGKAGSMLGSGAVIIMDEDTDMVEVLGRIAHFYYEESCGQCTPCREGTGWMSRMI
HRIANGQGKESDLKDLNEIAGNIMGRTICALGDAAAMPVQSFIKHFKDEFEAKIKQAVAT
QEQTAKHAVNE