Protein Info for B158DRAFT_0055 in Kangiella aquimarina DSM 16071

Annotation: sugar fermentation stimulation protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 TIGR00230: sugar fermentation stimulation protein" amino acids 1 to 232 (232 residues), 233.1 bits, see alignment E=1.4e-73 PF17746: SfsA_N" amino acids 14 to 80 (67 residues), 78.1 bits, see alignment E=4.6e-26 PF03749: SfsA" amino acids 84 to 227 (144 residues), 170.3 bits, see alignment E=2.1e-54

Best Hits

Swiss-Prot: 57% identical to SFSA_SHEB2: Sugar fermentation stimulation protein homolog (sfsA) from Shewanella baltica (strain OS223)

KEGG orthology group: K06206, sugar fermentation stimulation protein A (inferred from 88% identity to kko:Kkor_0357)

Predicted SEED Role

"Sugar/maltose fermentation stimulation protein homolog" in subsystem Fermentations: Mixed acid

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (241 amino acids)

>B158DRAFT_0055 sugar fermentation stimulation protein (Kangiella aquimarina DSM 16071)
MKFSPPLEKATLKKRYKRFLADVHNKEHGDFTAHCPNTGSMKNCWHEGDTVWLLDSENPK
RKYRYTWVIDETADGDLICINTHLANQIVMEGIAENTIKQLKGYDSVRQEVKYGDEKSRI
DLLLEDNKKPDCYVEIKTVTLLEQGKQFNSGAGFFPDAVSTRGQKHLRELMVMVEQGYRA
VLFFLVQHTGIKTVSPAAHIDPQYAKLLDQAATAGVEIIAYNTHISSAEIYLGNELPVII
P