Protein Info for Atu8092 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 198 signal peptide" amino acids 15 to 15 (1 residues), see Phobius details transmembrane" amino acids 16 to 35 (20 residues), see Phobius details amino acids 65 to 84 (20 residues), see Phobius details amino acids 138 to 170 (33 residues), see Phobius details PF10755: DUF2585" amino acids 31 to 194 (164 residues), 293.9 bits, see alignment E=1.6e-92

Best Hits

Swiss-Prot: 100% identical to Y8092_AGRFC: UPF0314 protein Atu8092 (Atu8092) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: None (inferred from 100% identity to atu:Atu8092)

Predicted SEED Role

"Intracellular septation protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8U527 at UniProt or InterPro

Protein Sequence (198 amino acids)

>Atu8092 hypothetical protein (Agrobacterium fabrum C58)
MTVAEMSASRSRSLRWFGVAAGLLLLQIVILYAMGRIPICECGYVKLFEPGVNTPGNSQH
LADWYTPSHIIHGFLFYWFAWLLFRNKPFSMRLSFAVLIEAAWELLENSPIIIDRYRTAT
TALGYTGDSILNSAMDTVFMALGFLFAARVPVWLTVVIAIFFEIFTGWLIRDNLTLNVVM
LVWPVDVIKEWQNALPQM