Protein Info for Atu6180 in Agrobacterium fabrum C58

Annotation: virA/G regulated protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 231 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF07015: VirC1" amino acids 1 to 230 (230 residues), 416.6 bits, see alignment E=4.7e-129 PF13614: AAA_31" amino acids 1 to 46 (46 residues), 27.1 bits, see alignment 7.8e-10 PF01656: CbiA" amino acids 5 to 190 (186 residues), 48.8 bits, see alignment E=1.4e-16

Best Hits

Swiss-Prot: 100% identical to VIRC1_AGRFC: Protein virC1 (virC1) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: None (inferred from 100% identity to atu:Atu6180)

Predicted SEED Role

"VirC1 protein promotes T-DNA transfer, ParA/MinD-like"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P07165 at UniProt or InterPro

Protein Sequence (231 amino acids)

>Atu6180 virA/G regulated protein (Agrobacterium fabrum C58)
MKLLTFCSFKGGAGKTTALMGLCAAFASDGKRLALFDADENRPLTRWKENALRSNTWGSF
CEVYAAEEMALLEAAYEDAELQGFDYALADTHGGSSELNNTIIASSNLLLIPTMLTPLDI
DEALSTYRYVIELLLSENLAIPTAVLRQRVPVGRLTTSQRAMSDMLASLPVVQSPMHERD
AFAAMKERGMLHLTLLNMRTDPTMRLLERNLRIAMEELVTISKLVSEALEG