Protein Info for Atu6177 in Agrobacterium fabrum C58

Annotation: component of type IV secretion system

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 TIGR02788: P-type DNA transfer ATPase VirB11" amino acids 17 to 325 (309 residues), 290.6 bits, see alignment E=6e-91 PF00437: T2SSE" amino acids 149 to 310 (162 residues), 100.8 bits, see alignment E=3.3e-33

Best Hits

Swiss-Prot: 100% identical to VIRBB_AGRFC: Protein VirB11 (virB11) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K03196, type IV secretion system protein VirB11 (inferred from 100% identity to atu:Atu6177)

Predicted SEED Role

"ATPase required for both assembly of type IV secretion complex and secretion of T-DNA complex, VirB11"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P07169 at UniProt or InterPro

Protein Sequence (344 amino acids)

>Atu6177 component of type IV secretion system (Agrobacterium fabrum C58)
MEVDPQLRILLKPILEWLDDPRTEEVAINRPGEAFVRQAGAFLKFPLPVSYDDLEDIAIL
AGALRKQDVGPRNPLCATELPDGERLQICLPPTVPSGTVSLTIRRPSSRVSSLKEVSSRY
DAPRWNQWKERKKRHDQHDEAILRYYDNGDLEAFLHACVVGRLTMLLCGPTGSGKTTMSK
TLINAIPPQERLITIEDTLELVIPHENHVRLLYSKNGAGLGAVTAEHLLQASLRMRPDRI
LLGEIRDDAAWAYLSEVVSGHPGSISTIHGANPVQGFKKLFSLVKSSAQGASLEDRTLID
MLATAVDVIVPFRAHGDIYEVGEIWLAADARRRGETIGDLLNQQ