Protein Info for Atu6166 in Agrobacterium fabrum C58

Annotation: two component sensor kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 833 transmembrane" amino acids 21 to 39 (19 residues), see Phobius details amino acids 260 to 280 (21 residues), see Phobius details PF19443: DAHL" amino acids 40 to 259 (220 residues), 130.7 bits, see alignment E=1.1e-41 PF00512: HisKA" amino acids 470 to 531 (62 residues), 44.4 bits, see alignment 2.1e-15 PF02518: HATPase_c" amino acids 577 to 696 (120 residues), 73.2 bits, see alignment E=3.5e-24

Best Hits

Swiss-Prot: 100% identical to VIRA_AGRFC: Wide host range VirA protein (virA) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K00936, [EC: 2.7.3.-] (inferred from 100% identity to atu:Atu6166)

Predicted SEED Role

"Two-component sensor kinase of vir regulon, VirA"

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P18540 at UniProt or InterPro

Protein Sequence (833 amino acids)

>Atu6166 two component sensor kinase (Agrobacterium fabrum C58)
MNGRYSPSRQDFKTGAKPWSILALVVAAMIFALMAITSWQDNETNRAILTQLRAINIDSA
SLQRDVLRAEAGVVANYRPIISRLGALRKNLENLKRLFKQSHLVIGNDFSQLLDKLKVSV
DTTDAAVAAFGAQNVLLQDSLASFTRALSILPKMSSTDQTVENSNELGSLMLRFVRQPSP
ALSLEISHELDMLQKASGGAEVPIRILAREGRVILSILPRVNDAVNMIQTSDTAEIAERL
ERKCLEAYSLQSVREQRARIFLGSVSVGLCIYIISLVYRLRRKTAWLTRRLDYEEVIKEI
GVCFEGGGATASSLNSSAQAALGIIQRFFNAESCALALVDHGDRWAVESFAAKLPEPVWE
DLALREMVSLARADERASVFRIMSTRKVSCLPPETPGVSMLLAHKSTDQLIAICSLGYQG
YRLKSCPGEVQLLELATACLCHYIDVRRKQTECDILERRLEHAERLQAVGTLAGGIAHEF
NNILGAILGYAEMAQNMLRRSSVTRRHIDQIISSGDRARLIIDQILTLSRKLERVTKPFS
VSELVMEIAPLLRVALQRNIELKFKFDDKKSVVEGSPLEVQQMLMNLCKNASQAFTADGQ
IDIIVSRIFVSRQKVLAHGVMPAGDYVLLSVSDDGEGIAETVLPHIFEPFFTTRSCSGGT
GLGLAAVHGHVSALAGYIDVTSAVGRGTRFDIYLPPSSKKPVSPDAFFGPCKTPRGNGEI
VALIEPDPVLREVYEDKIAALGYEPVGFKTCADLCNWISKGKQADLVLVDQSSLPENQSA
TALHAAFKTASIIIGGSDLKMSLSSDDMTSALFLPKPISSRTMAYAIRTKIKA