Protein Info for Atu6150 in Agrobacterium fabrum C58

Annotation: P-450 monooxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 419 PF00067: p450" amino acids 290 to 386 (97 residues), 72.3 bits, see alignment E=1.8e-24

Best Hits

Swiss-Prot: 77% identical to CPXC_RHIRD: Cytochrome P450-pinF1, plant-inducible (cyp103) from Rhizobium radiobacter

KEGG orthology group: K00517, [EC: 1.14.-.-] (inferred from 100% identity to atu:Atu6150)

Predicted SEED Role

"Plant-inducible protein PinF1, cytochrome P450-like, contributes to virulence"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.-.-

Use Curated BLAST to search for 1.14.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z2PIS2 at UniProt or InterPro

Protein Sequence (419 amino acids)

>Atu6150 P-450 monooxygenase (Agrobacterium fabrum C58)
MITSSISGTDQQFQNATQPKELDPDAVPVSRLDSEGHEIFAEWRPKRPFLRREDGVFLVL
RADDIFLLGTDPRTRQIETELMLNRGVTRGAVFDLIRYSMLFSNGEVHVKRRSAFAKTFA
FRMIDALRPEITKLTEHLWDDVPRVDDFDFAEMYASKLPALTIASVLGLPFGDAPFFTRL
VYNVSRCLSPSWGEDDFPEIEASAVELQDYVRAVVADRSRRISDDFLSCYLKAVREEGTL
SPIEEIMQLVFLILAGSDATRNAMVMLPTLLLQNPVVWSSLCHDQSGVAAAVEEGLRFEP
SVGSFPRLALEDIDLDGYVLPKGSFLALSIMSGLRDERHYEHPQLFDIKRKQMRRHLGFG
AGVHRCLGEALARIELQEGLRTLLRRAPSLRVTGDWPRMIGHGGARRATGMTVNLGVDR