Protein Info for Atu6132 in Agrobacterium fabrum C58

Annotation: methyl-accepting chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 579 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR00229: PAS domain S-box protein" amino acids 17 to 125 (109 residues), 55.2 bits, see alignment E=3.8e-19 amino acids 141 to 253 (113 residues), 41.9 bits, see alignment E=5e-15 PF08448: PAS_4" amino acids 21 to 125 (105 residues), 48 bits, see alignment E=4.1e-16 amino acids 142 to 247 (106 residues), 35.4 bits, see alignment E=3.3e-12 PF00989: PAS" amino acids 22 to 112 (91 residues), 34.9 bits, see alignment E=4e-12 PF13426: PAS_9" amino acids 23 to 123 (101 residues), 45.1 bits, see alignment E=3.2e-15 amino acids 148 to 244 (97 residues), 36 bits, see alignment E=2.2e-12 PF08447: PAS_3" amino acids 33 to 117 (85 residues), 51.1 bits, see alignment E=4e-17 amino acids 154 to 239 (86 residues), 46.1 bits, see alignment E=1.5e-15 PF00015: MCPsignal" amino acids 358 to 510 (153 residues), 163.6 bits, see alignment E=1.3e-51

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 100% identity to atu:Atu6132)

Predicted SEED Role

"Methyl-accepting chemotaxis protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See O68016 at UniProt or InterPro

Protein Sequence (579 amino acids)

>Atu6132 methyl-accepting chemotaxis protein (Agrobacterium fabrum C58)
MNILNRGANACAVLAALSKSQAMIEFDLSGRILTANDNFCRALGYELSEIIGKHHSMFVE
PAFVKSADYKAFWAKLAAGNFDQQQYKRIGKGGKEVWIEASYNPVMRRGKPVKVVKIATD
ITAQKLKVAEDAGKIEALSRAQAIIEFTPTGDVLTANENFLSALGYSLSEIQGKHHSMFC
EPSYTASPDYRNFWKMLAGGDLMADEFMRLGKGGRKVFIQASYNPIFDMNGRVFKVVKFA
TDVTTRVENVEQLAGCLNSLADGDLAQQIEKPFIPSLERLRTDFNAASDKLKRAMATVAD
NARAISAGSSEIRTAADELAKRTEQQAASVEETAAALEEITTTVKDSSRRAEEAGQLVAR
TREHAEHSGEVVRDAIGAMDQIETSSREISNIIGVIDEIAFQTNHLALNAGVEAARAGEA
GKGFAVVAQEVRELAQRSAKAAKEIKTLITSSGSQVQSGVSLVTKAGSALQEIATQVHDI
NTNVVAIVEAAREQSNALGEINKAVNSVDQGTQQNAAMVEEQTAASHSLAREAAALFELL
EHFRFDDSGRTQAFAGQVHQPSVAPVAKQSTRAAQVFAA