Protein Info for Atu6129 in Agrobacterium fabrum C58

Annotation: conjugal transfer protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 45 to 65 (21 residues), see Phobius details amino acids 85 to 105 (21 residues), see Phobius details amino acids 111 to 131 (21 residues), see Phobius details amino acids 137 to 156 (20 residues), see Phobius details PF00795: CN_hydrolase" amino acids 26 to 352 (327 residues), 180.4 bits, see alignment E=2.1e-57

Best Hits

Swiss-Prot: 100% identical to TRAB_AGRFC: Conjugal transfer protein TraB (traB) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: None (inferred from 100% identity to atu:Atu6129)

Predicted SEED Role

"Conjugal transfer protein TraB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q44351 at UniProt or InterPro

Protein Sequence (365 amino acids)

>Atu6129 conjugal transfer protein (Agrobacterium fabrum C58)
MLFPLLWAQSPSRLVAGAVSAGYFLTASRGLPQGVANFYAADFWHGLLLWLAASAGFVAV
HAAFWPARLQKRLPGRGALGWGKPVRYLAAAVLMGLPPFGITGWAHPLTAAGILFPGFGW
WGLGATTAGLAMMTSRYWPAAAIALGGFWFWSAATWTQPVLPDGWKGVDLEQGQTLGRDG
SLDHHRDLIATVRAAAGAETRVIVLPESALGLWTPTVARLWQAGLRGADVTVIAGAAVID
PGGYDNVMVTVSEGETRILYRERMPIPVSMWQPWLQWTGQGGGAQAHFFANPAVDLAGTR
IAPLICYEQLIVWPILHSMLFSPAAIVATGNGWWTEGTSIVAIQQAGVIAWAKLFGRPVV
TAFNT