Protein Info for Atu6124 in Agrobacterium fabrum C58

Annotation: conjugative transfer protein, Coupling protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 658 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 47 to 66 (20 residues), see Phobius details amino acids 74 to 92 (19 residues), see Phobius details amino acids 112 to 134 (23 residues), see Phobius details TIGR02767: Ti-type conjugative transfer system protein TraG" amino acids 5 to 634 (630 residues), 1113.7 bits, see alignment E=0 PF02534: T4SS-DNA_transf" amino acids 163 to 637 (475 residues), 572.8 bits, see alignment E=9.4e-176 PF10412: TrwB_AAD_bind" amino acids 301 to 609 (309 residues), 72.5 bits, see alignment E=4.9e-24 PF12696: TraG-D_C" amino acids 478 to 597 (120 residues), 101.4 bits, see alignment E=5.2e-33

Best Hits

Swiss-Prot: 100% identical to TRAG_AGRFC: Conjugal transfer protein TraG (traG) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K03205, type IV secretion system protein VirD4 (inferred from 100% identity to atu:Atu6124)

Predicted SEED Role

"Conjugal transfer protein traG"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q44346 at UniProt or InterPro

Protein Sequence (658 amino acids)

>Atu6124 conjugative transfer protein, Coupling protein (Agrobacterium fabrum C58)
MTMNRLLLLILPAIIMLAAMFATSGMEQRLAAFGTSPQAKLMLGRAGLALPYIAAVAIGI
IGLFAANGSANIKAAGLSVLAGSGVVITIATLREVIRLNSIASSVPAEQSVLAYADPVTM
IGASIAFISGMFALRVAIKGNAAFATTAPKRIGGKRAVHGEADWMKIQEAAKLFPERGGI
IIGERYRVDRDSVAAMPFRADDRQSWGAGGKSPLLCFDGSFGSSHGIVFAGSGGFKTTSV
TIPTALKWGGGLVVLDPSSEVAPMVCEHRRQAGRKVIVLDPTAGGVGFNALDWIGRHGNT
KEEDIVAVATWIMTDNPRTASARDDFFRASAMQLLTALIADVCLSGHTETEDQTLRRVRA
NLSEPEPKLRARLTKIYEGSESDFVKENVSVFVNMTPETFSGVYANAVKETHWLSYPNYA
GLVSGDSFSTDDLADGGTDIFIALDLKVLEAHPGLARVVIGSLLNAIYNRNGNVKGRTLF
LLDEVARLGYLRILETARDAGRKYGIMLTMIFQSLGQMREAYGGRDATSKWFESASWISF
AAINDPDTADYISKRCGDTTVEVDQTNRSTGMKGSSRSRSKQLSRRPLILPHEVLHMRSD
EQIVFTSGNPPLRCGRAIWFRRDDMKACVGENRFHRTGTGTDTHTEHAPPWQKEGTRP