Protein Info for Atu6086 in Agrobacterium fabrum C58

Annotation: ABC transporter, membrane spanning protein (nitrate/sulfonate)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 transmembrane" amino acids 15 to 36 (22 residues), see Phobius details amino acids 41 to 42 (2 residues), see Phobius details amino acids 45 to 61 (17 residues), see Phobius details amino acids 74 to 98 (25 residues), see Phobius details amino acids 111 to 130 (20 residues), see Phobius details amino acids 136 to 155 (20 residues), see Phobius details amino acids 176 to 193 (18 residues), see Phobius details amino acids 199 to 220 (22 residues), see Phobius details amino acids 231 to 250 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 84 to 257 (174 residues), 92.7 bits, see alignment E=1.2e-30

Best Hits

Swiss-Prot: 64% identical to SSUC_ECOLI: Putative aliphatic sulfonates transport permease protein SsuC (ssuC) from Escherichia coli (strain K12)

KEGG orthology group: K02050, sulfonate/nitrate/taurine transport system permease protein (inferred from 100% identity to ara:Arad_14002)

MetaCyc: 64% identical to aliphatic sulfonate ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-56-RXN [EC: 7.6.2.14]

Predicted SEED Role

"Alkanesulfonates transport system permease protein" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z2PJU4 at UniProt or InterPro

Protein Sequence (266 amino acids)

>Atu6086 ABC transporter, membrane spanning protein (nitrate/sulfonate) (Agrobacterium fabrum C58)
MITTSAKTPTTAGRYLAQAFAPWAFPVIVVILWQIASSGGLLSQGILPSPLAVLEAAWSL
AASGELVQHMAASFWRAAVGFGIGSALGLFFGFVNGLWRTGETLFDSSLQMLRNIPSLAM
VPLVIMWFGIGEEAKIFLVAFATMFPIYLNTFHGIKSVDQGLIEMGRNYGLTRTGLVRDV
ILPGAMSSILVGVRYALGVAWIVLIVAETIAASSGIGLLATNAREFLQSDVVVLSIILYA
LLGKLTDWLARLAENRWLRWHPSYQK