Protein Info for Atu6085 in Agrobacterium fabrum C58

Annotation: ABC transporter, substrate binding protein (nitrate/sulfonate)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 310 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details TIGR01728: ABC transporter, substrate-binding protein, aliphatic sulfonates family" amino acids 28 to 305 (278 residues), 189.8 bits, see alignment E=3.2e-60 PF13379: NMT1_2" amino acids 40 to 247 (208 residues), 54.4 bits, see alignment E=2.6e-18 PF12974: Phosphonate-bd" amino acids 52 to 219 (168 residues), 40.1 bits, see alignment E=4.1e-14 PF09084: NMT1" amino acids 58 to 239 (182 residues), 49 bits, see alignment E=1.1e-16

Best Hits

KEGG orthology group: K02051, sulfonate/nitrate/taurine transport system substrate-binding protein (inferred from 100% identity to ara:Arad_14001)

Predicted SEED Role

"Alkanesulfonates-binding protein" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization or Putative sulfate assimilation cluster

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z2PP31 at UniProt or InterPro

Protein Sequence (310 amino acids)

>Atu6085 ABC transporter, substrate binding protein (nitrate/sulfonate) (Agrobacterium fabrum C58)
MKTKSIIRLALSLALSVAATVASAQDVLRVGDQRGNARAVMDASGVLKDVPYQVEWSEFA
NAAPLLEALAAEALDAGSVGDAPLTFAAARGVKAKAIFATKYEGNAIIVKNDAPYQGIKD
LVRKKVAFVKGSAGHALILQSLKEAGLKEDAITPVFLPPAEATLALTNGSVDAVSLWEPY
ISFATLKSGARIIVDGKNYPSLSYFIASEAAIEGKRDILKDFVARSAKARAWGLEHPQEY
SKIIAQLVKIPDDVALGKQTRERHAPQLINADVEKLQQSTIDLYYGAGIIDKKLKASDLL
DDSFSPKQTD