Protein Info for Atu6078 in Agrobacterium fabrum C58

Annotation: conserved hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 408 PF00296: Bac_luciferase" amino acids 57 to 377 (321 residues), 191.3 bits, see alignment E=1.4e-60

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu6078)

Predicted SEED Role

"Coenzyme F420-dependent N5,N10-methylene tetrahydromethanopterin reductase and related flavin-dependent oxidoreductases; sulfonate monooxygenase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A2Z2PKF8 at UniProt or InterPro

Protein Sequence (408 amino acids)

>Atu6078 conserved hypothetical protein (Agrobacterium fabrum C58)
MTRDPHHTLTSTELTQNDPVPSPADFDESPVARIFRQPTMLGLFLPLNAGGWSASHLPRT
TSWDFGYNRNLVRIADELGFDIVFGLSQWLPKGGFGEVLNGTSLDPFVTMAALATETKNI
LLASTVHILYGPWHPLHLARAGATLDHITNGRWGLNVVTGHRRIEHEMFGGSQIEHDQRY
RLADEFVNALKALWRSDEPVTFSGKSPWRIKEGFITPKPRFGRPLLISATGSPAGIDFAA
RQSDIVFVTSPGGGSFEAARASLGAHTATVKAAAARNGRTIRVILNPIIVCRDTDQEAQE
YYGAIVAAVEQRNVGGLHNIADTKDFDKRLVSDAQAWAKSNDVNSVDAIAVGGNVRLVGS
PQRIVEQLAALHAEGVDGFHISFFDYLPDLTHFGRTVLPLMRAAGLRL