Protein Info for Atu6064 in Agrobacterium fabrum C58

Annotation: haloalkane dehalogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 280 PF00561: Abhydrolase_1" amino acids 18 to 149 (132 residues), 72 bits, see alignment E=6.4e-24 PF12697: Abhydrolase_6" amino acids 19 to 268 (250 residues), 57.9 bits, see alignment E=2.4e-19

Best Hits

Swiss-Prot: 100% identical to DHAA_AGRFC: Haloalkane dehalogenase (dhaA) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K01563, haloalkane dehalogenase [EC: 3.8.1.5] (inferred from 100% identity to ara:Arad_14216)

Predicted SEED Role

"Haloalkane dehalogenase (EC 3.8.1.5)" (EC 3.8.1.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.8.1.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8U671 at UniProt or InterPro

Protein Sequence (280 amino acids)

>Atu6064 haloalkane dehalogenase (Agrobacterium fabrum C58)
MPAFGLQIHTVEHGSGAPIVFLHGNPTSSYLWRHIFRRLHGHGRLLAVDLIGYGQSSKPD
IEYTLENQQRYVDAWFDALDLRNVTLVLQDYGAAFGLNWASRNPDRVRAVAFFEPVLRNI
DSVDLSPEFVTRRAKLRQPGEGEIFVQQENRFLTELFPWFFLTPLAPEDLRQYQTPFPTP
HSRKAILAGPRNLPVDGEPASTVAFLEQAVNWLNTSDTPKLLLTFKPGFLLTDAILKWSQ
VTIRNLEIEAAGAGIHFVQEEQPETIARLLDAWLTRIAGN