Protein Info for Atu6062 in Agrobacterium fabrum C58

Annotation: 2-deoxy-D-gluconate 3-dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 PF00106: adh_short" amino acids 21 to 205 (185 residues), 172.4 bits, see alignment E=1.6e-54 PF08659: KR" amino acids 22 to 189 (168 residues), 31.8 bits, see alignment E=2.6e-11 PF01370: Epimerase" amino acids 22 to 132 (111 residues), 26.1 bits, see alignment E=1.1e-09 PF13561: adh_short_C2" amino acids 26 to 253 (228 residues), 203.7 bits, see alignment E=6.9e-64

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu6062)

Predicted SEED Role

"2-deoxy-D-gluconate 3-dehydrogenase (EC 1.1.1.125)" in subsystem D-Galacturonate and D-Glucuronate Utilization (EC 1.1.1.125)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.125

Use Curated BLAST to search for 1.1.1.125

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CKY9 at UniProt or InterPro

Protein Sequence (256 amino acids)

>Atu6062 2-deoxy-D-gluconate 3-dehydrogenase (Agrobacterium fabrum C58)
MTYPSQIPNISKLFDLSGRRAVITGGARGIGRAIADGFLEVGADVVCIDRGWESSDLPAD
NRQIVTADLSDRSDLKRGFDEAVERLGGQIDVLVNNAGIWDDTPSLHMELEMWDRIIEVN
LTAAFALSRHAARLMLPRGRGRIINIGSIRSLRGGHNAAAYAASKGGIALLTQTLSNEWA
PSGLRVNAIAPGAMVTVLTEKLRHDPEVVTRFIERIPARRWGSPADVAGLAIFLASDASD
YVTGAIIPCDGGFLAG