Protein Info for Atu6044 in Agrobacterium fabrum C58

Annotation: replication protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 370 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details TIGR03454: plasmid partitioning protein RepB" amino acids 36 to 359 (324 residues), 366.6 bits, see alignment E=1.3e-113 TIGR00180: ParB/RepB/Spo0J family partition protein" amino acids 102 to 270 (169 residues), 104.5 bits, see alignment E=5.8e-34 PF02195: ParBc" amino acids 102 to 191 (90 residues), 69.8 bits, see alignment E=1.8e-23 PF07506: RepB" amino acids 194 to 359 (166 residues), 96.7 bits, see alignment E=1.9e-31

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu6044)

Predicted SEED Role

"Plasmid replication protein RepB" in subsystem Plasmid replication

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CL02 at UniProt or InterPro

Protein Sequence (370 amino acids)

>Atu6044 replication protein (Agrobacterium fabrum C58)
MARVQLSCLVGSSQPSAFAIKNATPRRQTQEADIMSRKDAIDTLFLKKQPATDRAAVDKS
TARVRTGAISAMGSSLQEMAEGAKAAARLQDQLATGEAVVSLDPSMIDGSPIADRLPSDV
DPKFEQLEASISQEGQQVPVLVRPHPEAAGRYQIVYGRRRLRAAVNLRREVSAIVRNLTD
CELVVAQGRENLNRADLSFIEKALFALRLEDAGFDRATIIAALSTDKADLSRYITVARGI
PLNLATQIGPASKAGRSRWVVLAEGLGKPKATDAIEAMLGSEQFKQSDSDTRFNLIFNAV
SRPPAKTPKKVRAWSTPKGKKAATIRQETGRTALVFDERLVPTFGEYVADQLDSLYAQFI
ETNGGGKLDQ