Protein Info for Atu6042 in Agrobacterium fabrum C58

Annotation: autoinducer synthesis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 211 PF00765: Autoind_synth" amino acids 9 to 191 (183 residues), 286.5 bits, see alignment E=7.4e-90 PF13444: Acetyltransf_5" amino acids 24 to 113 (90 residues), 26.1 bits, see alignment E=1.2e-09

Best Hits

Swiss-Prot: 100% identical to TRAI_AGRFC: Acyl-homoserine-lactone synthase (traI) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: None (inferred from 100% identity to atu:Atu6042)

MetaCyc: 100% identical to acyl-homoserine-lactone synthase (Agrobacterium fabrum C58)
Acyl-homoserine-lactone synthase. [EC: 2.3.1.184]; 2.3.1.184 [EC: 2.3.1.184]

Predicted SEED Role

"acyl-homoserine-lactone synthase TraI"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.184

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P33907 at UniProt or InterPro

Protein Sequence (211 amino acids)

>Atu6042 autoinducer synthesis protein (Agrobacterium fabrum C58)
MRILTVSPDQYERYRSFLKQMHRLRATVFGGRLEWDVSIIAGEERDQYDNFKPSYLLAIT
DSGRVAGCVRLLPACGPTMLEQTFSQLLEMGSLAAHSGMVESSRFCVDTSLVSRRDASQL
HLATLTLFAGIIEWSMASGYTEIVTATDLRFERILKRAGWPMRRLGEPTAIGNTIAIAGR
LPADRASFEQVCPPGYYSIPRIDVAAIRSAA