Protein Info for Atu6029 in Agrobacterium fabrum C58

Annotation: transcriptional regulator, LysR family for nopaline metabolism

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 282 PF00126: HTH_1" amino acids 2 to 44 (43 residues), 47.6 bits, see alignment 1.3e-16 PF03466: LysR_substrate" amino acids 72 to 274 (203 residues), 132.2 bits, see alignment E=1.8e-42

Best Hits

Swiss-Prot: 100% identical to NOCR_AGRT7: Regulatory protein NocR (nocR) from Agrobacterium tumefaciens (strain T37)

KEGG orthology group: None (inferred from 100% identity to atu:Atu6029)

Predicted SEED Role

"LysR-type transcriptional regulator for nopaline catabolism NocR" in subsystem Agrobacterium opine transport

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q00678 at UniProt or InterPro

Protein Sequence (282 amino acids)

>Atu6029 transcriptional regulator, LysR family for nopaline metabolism (Agrobacterium fabrum C58)
MTSAANLVRITQPAISRLIRDLEEEIGISLFERTGNRLRPTREAGILFKEVSRHFNGIQH
IDKVAAELKKSHMGSLRVACYTAPALSFMSGVIQTFIADRPDVSVYLDTVPSQTVLELVS
LQHYDLGISILAGDYPGLTTEPVPSFRAVCLLPPGHRLEDKETVHATDLEGESLICLSPV
SLLRMQTDAALDSCGVHCNRRIESSLALNLCDLVSRGMGVGIVDPFTADYYSANPVIQRS
FDPVVPYHFAIVLPTDSPPPRLVSEFRAALLDALKALPYETI