Protein Info for Atu6027 in Agrobacterium fabrum C58

Annotation: ABC transporter, substrate binding protein (nopaline)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details TIGR01096: lysine-arginine-ornithine-binding periplasmic protein" amino acids 6 to 275 (270 residues), 317.5 bits, see alignment E=3e-99 PF00497: SBP_bac_3" amino acids 31 to 276 (246 residues), 137.4 bits, see alignment E=2.6e-44 PF10613: Lig_chan-Glu_bd" amino acids 74 to 122 (49 residues), 31.6 bits, see alignment 1.6e-11

Best Hits

Swiss-Prot: 100% identical to NOCT_AGRFC: Nopaline-binding periplasmic protein (nocT) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K10018, octopine/nopaline transport system substrate-binding protein (inferred from 100% identity to atu:Atu6027)

Predicted SEED Role

"Nopaline transporter periplasmic substrate-binding protein NocT" in subsystem Agrobacterium opine transport

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P35120 at UniProt or InterPro

Protein Sequence (283 amino acids)

>Atu6027 ABC transporter, substrate binding protein (nopaline) (Agrobacterium fabrum C58)
MKFFNLNALAAVVTGVLLAAGPTQAKDYKSITIATEGSYAPYNFKDAGGKLIGFDIDLGN
DLCKRMNIECKFVEQAWDGIIPSLTAGRYDAIMAAMGIQPAREKVIAFSRPYLLTPMTFL
TTADSPLLKTQVAIENLPLDNITPEQKAELDKFTKIFEGVKFGVQAGTSHEAFMKQMMPS
VQISTYDTIDNVVMDLKAGRIDASLASVSFLKPLTDKPDNKDLKMFGPRMTGGLFGKGVG
VGIRKEDADLKALFDKAIDAAIADGTVQKLSQQWFGYDASPKQ