Protein Info for Atu6026 in Agrobacterium fabrum C58

Annotation: ABC transporter, membrane spanning protein (nopaline)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 236 transmembrane" amino acids 20 to 45 (26 residues), see Phobius details amino acids 66 to 88 (23 residues), see Phobius details amino acids 100 to 119 (20 residues), see Phobius details amino acids 177 to 195 (19 residues), see Phobius details amino acids 201 to 222 (22 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 16 to 124 (109 residues), 49 bits, see alignment E=3.6e-17 PF00528: BPD_transp_1" amino acids 35 to 215 (181 residues), 75.6 bits, see alignment E=2.1e-25

Best Hits

Swiss-Prot: 100% identical to NOCQ_AGRFC: Nopaline transport system permease protein NocQ (nocQ) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K10020, octopine/nopaline transport system permease protein (inferred from 100% identity to atu:Atu6026)

Predicted SEED Role

"Nopaline transporter permease protein NocQ" in subsystem Agrobacterium opine transport

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P35118 at UniProt or InterPro

Protein Sequence (236 amino acids)

>Atu6026 ABC transporter, membrane spanning protein (nopaline) (Agrobacterium fabrum C58)
MDLTLLQWGDAGWGDELARGAMMTVVVAACSYFFGIIFGSLFAAAKLSRFWSLRLLGDVY
TTVVRGVPELLIIFLVFFGGGTLLRTIANGLFGYEGYIEPPIFVIGVLCISVSAGAYATE
VIRAAVLAVPPGQIEAAKSIGMGPWLRLRRVLIPQAARFALPGLGNVWQFTLKDTSLISV
VGLVEIMRTAAMGAGSTKQPFTFYITAFVIFLLLSSVSNRGFLKAEKWANRGVRSQ