Protein Info for Atu6025 in Agrobacterium fabrum C58

Annotation: ABC transporter, membrane spanning protein (nopaline)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 53 to 74 (22 residues), see Phobius details amino acids 94 to 112 (19 residues), see Phobius details amino acids 169 to 183 (15 residues), see Phobius details amino acids 196 to 221 (26 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 10 to 117 (108 residues), 79 bits, see alignment E=1.6e-26 PF00528: BPD_transp_1" amino acids 33 to 215 (183 residues), 80.8 bits, see alignment E=5.5e-27

Best Hits

Swiss-Prot: 100% identical to NOCM_AGRFC: Nopaline transport system permease protein NocM (nocM) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K10019, octopine/nopaline transport system permease protein (inferred from 100% identity to atu:Atu6025)

Predicted SEED Role

"Histidine ABC transporter, permease protein HisM (TC 3.A.1.3.1)" in subsystem Arginine and Ornithine Degradation (TC 3.A.1.3.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P35113 at UniProt or InterPro

Protein Sequence (241 amino acids)

>Atu6025 ABC transporter, membrane spanning protein (nopaline) (Agrobacterium fabrum C58)
MDIQLIIESFPKLLAAVPTTLTLAFISLLIGFVVSVPVALMRLSKNRIVSSLAYGYVYII
RSTPLLVQMFLIYYGSAQFRGVLSEVGLWSSFREPWFCAILALALNTAAYTSEIIRGGIQ
SVSLGQIEAARAVGMSTFLQFRRIVFPIAIRQALPAYGNEVMLIIKSTSLASTITIVEVT
GLAKQIISATYSPVEVFIVAGAIYLFITFVVSRLVMLAEWWLNPHMRARVGGTAPKAAET
H