Protein Info for Atu5532 in Agrobacterium fabrum C58

Annotation: ABC transporter membrane spanning protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 269 transmembrane" amino acids 7 to 26 (20 residues), see Phobius details amino acids 31 to 48 (18 residues), see Phobius details amino acids 60 to 78 (19 residues), see Phobius details amino acids 120 to 141 (22 residues), see Phobius details amino acids 171 to 193 (23 residues), see Phobius details amino acids 206 to 230 (25 residues), see Phobius details amino acids 242 to 264 (23 residues), see Phobius details TIGR03409: urea ABC transporter, permease protein UrtB" amino acids 1 to 269 (269 residues), 321.2 bits, see alignment E=4e-100 PF02653: BPD_transp_2" amino acids 1 to 255 (255 residues), 114.6 bits, see alignment E=2.4e-37

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 100% identity to atu:Atu5532)

Predicted SEED Role

"Urea ABC transporter, permease protein UrtB" in subsystem Urea decomposition

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7D2U5 at UniProt or InterPro

Protein Sequence (269 amino acids)

>Atu5532 ABC transporter membrane spanning protein (Agrobacterium fabrum C58)
MGVINMAHGEMVMIGAYVAVLSGIWLKTSLLLAIPLAFVVTALLGLIIERVVVRRLYGRL
LDTLLATWGIAILLQQAVRLELGLTFLGIHIEGLGAGLQNVAVPSYLQGTFRFAGADINA
YRTFIIAVTAALTLATWFILYRTTAGMQVRAIIRNPKMAAACGIDVKRINALTFAFGSGL
AGVAGVMMSGFKTVFPDMGTTMVVDGFMVVVTGGVGSLFGTALSSGLLGEINALVAIGTN
DILARAVVFGVVILVILVKPSGLFSFKGR