Protein Info for Atu5525 in Agrobacterium fabrum C58

Annotation: ABC transporter nucleotide binding/ATPase (branched chain amino acid)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details PF00005: ABC_tran" amino acids 62 to 223 (162 residues), 103.9 bits, see alignment E=1.1e-33 PF12399: BCA_ABC_TP_C" amino acids 272 to 294 (23 residues), 41.9 bits, see alignment (E = 5.6e-15)

Best Hits

Swiss-Prot: 42% identical to BRAF_PSEAE: High-affinity branched-chain amino acid transport ATP-binding protein BraF (braF) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01995, branched-chain amino acid transport system ATP-binding protein (inferred from 100% identity to atu:Atu5525)

Predicted SEED Role

"Branched-chain amino acid transport ATP-binding protein LivG (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7D2V2 at UniProt or InterPro

Protein Sequence (305 amino acids)

>Atu5525 ABC transporter nucleotide binding/ATPase (branched chain amino acid) (Agrobacterium fabrum C58)
MSASNFLLASLGAEVAVPADIREYVALHGERVEHDRRAPHQAEGLALELRGIDLSFGGIA
ALQDIDLAVRHGEIRAIIGPNGAGKSSLINVISGVYRPDRGYVAIDGTAYRPVPTQKLAR
LGVARTFQNLALFKGLSVLDNVAAGRAYVSRANFLSQVAGLPLARREQADARERAGRILE
FLHLTPYVDRLAGTLPYGLQKRVELARALAAEPRILLLDEPMAGMTATEKNELADYVRLA
RDEYAITVVLIEHDVGVVMGLSDRIAVLDYGRKIADGTPAEIASDQRVIDAYLGIAPENE
DGEGI