Protein Info for Atu5518 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 502 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details amino acids 31 to 31 (1 residues), see Phobius details transmembrane" amino acids 29 to 30 (2 residues), see Phobius details PF13454: NAD_binding_9" amino acids 15 to 167 (153 residues), 124.6 bits, see alignment E=7.1e-40 PF13450: NAD_binding_8" amino acids 16 to 75 (60 residues), 29.3 bits, see alignment E=1.7e-10 PF13434: Lys_Orn_oxgnase" amino acids 146 to 257 (112 residues), 21.9 bits, see alignment E=1.8e-08

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu5518)

Predicted SEED Role

"Hydroxyacylglutathione hydrolase (EC 3.1.2.6)" in subsystem Glutathione: Non-redox reactions or Methylglyoxal Metabolism (EC 3.1.2.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.6

Use Curated BLAST to search for 3.1.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CL31 at UniProt or InterPro

Protein Sequence (502 amino acids)

>Atu5518 hypothetical protein (Agrobacterium fabrum C58)
MSSFVPIASARVTVAVVGGGFTGAAMAVHLVAGKAIPADMSVVVIEPRPELGRGLAYSAT
DPAHRVNVPAARMTLFPDIPDDFESYLNGVSADDDTELMGHDGSPYPKRSVFGDYVSARI
QPFLDDGRIRHWRTKAISVSQRGSRYEIIGSDGTVLIADIVVLAVSHPPPFLPRVLQPFK
DDPKLIADVTVADAIDVVERGDHVLIVGNGLTSADVVASLKRRGHVGQITSISRRGLRSR
GHGPAEQGPFGDFLSEPFNSASKLLHHVRHLLREAEQQGMTWHSVVDALRGQGNEIWKNL
PVVERRRIARHLRPIWDVHRFRIAPQVEVAVEQATASGQMDVRAASLSSVVRIDAGYRVM
LRPRRGSVNEVLDVDAIVVTTGPAHGGILQSQALLRDLEEAGLLQPCPTGLGILVDAKSN
PLSASGVSTTSLFVAGPLARGTFGELMGLPQVTEHAIFVAEQIRGSLDEHRISYPPAQVA
ETYPESDRTTGLQRSKSQTIVP