Protein Info for Atu5490 in Agrobacterium fabrum C58

Annotation: ECF family RNA polymerase sigma factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 180 PF04542: Sigma70_r2" amino acids 28 to 92 (65 residues), 52.6 bits, see alignment E=3.3e-18 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 30 to 173 (144 residues), 72.9 bits, see alignment E=1.2e-24 PF08281: Sigma70_r4_2" amino acids 118 to 169 (52 residues), 45.9 bits, see alignment E=3.5e-16

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 100% identity to atu:Atu5490)

Predicted SEED Role

"ECF family sigma factor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CL45 at UniProt or InterPro

Protein Sequence (180 amino acids)

>Atu5490 ECF family RNA polymerase sigma factor (Agrobacterium fabrum C58)
MAKHAVSGAPGNTLTEAQLEVLRSGIADLAPALTAFARRFVRNEDDVNDLVQETMLRGFR
SLQGFTPGTALKSWLFTILRNTFCTRYKVSRRECVGLPVGIEQSMSIPADQEWRLQHQEV
MRAILELDKDQKKALLLIAGGTSYSDAAAICGCRVGTIKSRVNRARESLRQKLDRVGTPH