Protein Info for Atu5476 in Agrobacterium fabrum C58

Annotation: CTP synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00117: GATase
  • amino acids 210 to 396 (187 residues), 67.6 bits, E=1.2e-22
• PF07722: Peptidase_C26
  • amino acids 236 to 380 (145 residues), 23.8 bits, E=3.6e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu5476)

Predicted SEED Role

"CTP synthase (EC 6.3.4.2)" (EC 6.3.4.2)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (17/18 steps found)
• superpathway of pyrimidine ribonucleotides de novo biosynthesis (8/9 steps found)
• L-citrulline biosynthesis (7/8 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (4/4 steps found)
• superpathway of pyrimidine nucleobases salvage (4/4 steps found)
• UTP and CTP de novo biosynthesis (3/3 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• superpathway of pyrimidine ribonucleosides salvage (8/10 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• superpathway of L-citrulline metabolism (9/12 steps found)
• L-glutamine degradation I (1/1 steps found)
• UTP and CTP dephosphorylation I (5/7 steps found)
• L-glutamate and L-glutamine biosynthesis (4/7 steps found)
• UTP and CTP dephosphorylation II (1/3 steps found)

KEGG Metabolic Maps

• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 6.3.4.2

Use Curated BLAST to search for 6.3.4.2

Sequence Analysis Tools

See A9CL53 at UniProt or InterPro

Protein Sequence (407 amino acids)

>Atu5476 CTP synthase (Agrobacterium fabrum C58)
MGLILVHHDTGSPALYGAAAAAVAVRRNCGFMHLASRFDTKRHADAEQHVVASGGLAASG
LCWFERLSGKPIEPVAPIEAVIDAAREADIVVPIHPAFLADANAIAGLFAAAQLQAVSVE
TIRIADGVHQFADDATGTVITWRDQFGRIRLDKPKAPTETVLTIALVGARSDHVDVYPAA
LASLADAADSLRLPLAINFIDPVGFDEAYAEQTLRPYAGILLPGGANMKNVAGQTAVAAF
ALENQLPIVGLCLGMQTMATAVAWRAFGRRNANLAEADPDVGIKTFLAMAGGTTADGGPL
PEHRTGDQQTVPTAGTRLAGLIPHGTIVRCNHRYRLNPDLVRDMETHGLRVAARGVNGSV
VDAIEVVGHPFYMGMQGHPELSSRPDAPHPLLVAFLEAALRRQSQAS