Protein Info for Atu5453 in Agrobacterium fabrum C58

Annotation: ABC transporter membrane spanning protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 802 signal peptide" amino acids 1 to 40 (40 residues), see Phobius details transmembrane" amino acids 225 to 248 (24 residues), see Phobius details amino acids 265 to 314 (50 residues), see Phobius details amino acids 326 to 347 (22 residues), see Phobius details amino acids 370 to 391 (22 residues), see Phobius details amino acids 397 to 423 (27 residues), see Phobius details amino acids 444 to 469 (26 residues), see Phobius details amino acids 666 to 695 (30 residues), see Phobius details amino acids 717 to 746 (30 residues), see Phobius details amino acids 763 to 783 (21 residues), see Phobius details PF02687: FtsX" amino acids 229 to 353 (125 residues), 43 bits, see alignment E=4.4e-15 amino acids 673 to 791 (119 residues), 46.5 bits, see alignment E=3.6e-16 PF12704: MacB_PCD" amino acids 449 to 613 (165 residues), 44.9 bits, see alignment E=1.8e-15

Best Hits

KEGG orthology group: K02004, (no description) (inferred from 100% identity to atu:Atu5453)

Predicted SEED Role

"AttG component of AttEFGH ABC transport system"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7D317 at UniProt or InterPro

Protein Sequence (802 amino acids)

>Atu5453 ABC transporter membrane spanning protein (Agrobacterium fabrum C58)
MNRTAFQALLSHWRHRPLQLFTLFVGVALATALWSAVQAINAEARASYDRAASVLAQNQL
DQLVAKDGSTISSNTYARLRRAGLDVSPIIEGEHRFGTTRIRLIGIDPLTMPSEGRVLPV
GEPSGLIDFMTAPGVMIVSPATAGTLKDTSGLPIKMAANIPDGAGFVDISTADRVLHRNG
NLSRIVVSPTQKLDIQAVATVAPELSLKEAGGRSDVARLTDSFHLNLTAFGFLAFVVGLF
IAYSATGLSFEQRRGTFRTLRSLGIPLSSLTTMLVIEITLFALVAGALGVVLGYVVASTL
LPGVAATLSGLYGARVAGSLSIRPEWWLTGLGMALVGTWLSSLQHLYRVWRMPILSTAHS
RGWTMASVKSLVLQAIAGIFLIALSSLLIWIGSGLLAGFAILAAFLLGAAFILPPLLALA
LRAGERSSRHVLARWFFADTRQQLPGLSLALMALLLALSANIGVGTMVSSFRQTFLRWLD
QRLAAEVYVTARDEAEAARLRKWFPDHARAVLPIWSTRGEVSGAQVQIFGVADDPTYRDH
WPLILGSATTWDEIASGRGALVNEQFWRSGNASLGQKIILPGGWSATVVGIFSDYGNPMG
QVIIGINALNQHYPDVEKLRYGLRVAPDDTADFRRRLIDDFGLPQDNIVDQASLKRQSAA
IFEQTFAVTGALNILTLAVAGFAMFSSLLTLASLRLPQLAPVWALGLRRRDLAWLEFIRA
LTLWFVTFVAAIPVGLALAWVLLTIINVEAFGWRLPMILFPWEWVKLGLVALFAAVISVL
IPVRQLAKTAPADLLRVFANER