Protein Info for Atu5452 in Agrobacterium fabrum C58

Annotation: ABC transporter nucleotide binding/ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 219 PF00005: ABC_tran" amino acids 22 to 167 (146 residues), 107.3 bits, see alignment E=5.2e-35

Best Hits

Swiss-Prot: 41% identical to LOLD_LEGPH: Lipoprotein-releasing system ATP-binding protein LolD (lolD) from Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513)

KEGG orthology group: K02003, (no description) (inferred from 100% identity to atu:Atu5452)

Predicted SEED Role

"AttE component of AttEFGH ABC transport system"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CL64 at UniProt or InterPro

Protein Sequence (219 amino acids)

>Atu5452 ABC transporter nucleotide binding/ATPase (Agrobacterium fabrum C58)
MILAICDIRKTYETAEGAIPVLNGVGLSLDAGESLALTGESGSGKSTLLHLVGGLELPDS
GTIMVRDRNIVDLDDRGRALFRRRDVGLIFQQFNLIPSLDVGSNISFHAKLAGRCDPTWE
KTLVEALGIAALLGRYPEQLSGGQQQRVAIARTLAARPPLILADEPTGNLDEATADIVID
IMLQLAKSAKIALLLVTHSSRLAAKLDRRITLTGGKVSQ