Protein Info for Atu5421 in Agrobacterium fabrum C58

Annotation: ABC transporter membrane spanning protein (putrescine)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 transmembrane" amino acids 48 to 69 (22 residues), see Phobius details amino acids 107 to 133 (27 residues), see Phobius details amino acids 145 to 168 (24 residues), see Phobius details amino acids 188 to 210 (23 residues), see Phobius details amino acids 249 to 271 (23 residues), see Phobius details amino acids 298 to 319 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 192 to 317 (126 residues), 26.5 bits, see alignment E=2.4e-10

Best Hits

KEGG orthology group: K02054, putative spermidine/putrescine transport system permease protein (inferred from 100% identity to atu:Atu5421)

Predicted SEED Role

"Spermidine Putrescine ABC transporter permease component PotB (TC 3.A.1.11.1)" in subsystem Polyamine Metabolism (TC 3.A.1.11.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7D347 at UniProt or InterPro

Protein Sequence (327 amino acids)

>Atu5421 ABC transporter membrane spanning protein (putrescine) (Agrobacterium fabrum C58)
MVNTTMTELREESAPAPAHYSGWIGKVTGSTLYRTTIGRLADSRHARLALLAGIPVIWLF
VLHVGPILQMANISFTDNYPPQPNEATRYTLANYALFFSDSIYVLPFIRSLVFAAVVTVS
TLVIVYPVAYYVAKVLQPKQRMRALLLLLIPFWAGELIRTFSVIMLLANRGAVNVLLREI
GVIDRPIPMLYTSFSLSFGVIYLLALYMLLPLYSAIEKIPVQLVHAAADLGASPFQRFRR
VILPLSKDGIVSGCSLVYLTAVGVFAAPLLLGGPNAVIFPEVIATLFHSSNDKWPEGAAF
AMLMLAVSLTTVGLFMRVVGGRSVRLM