Protein Info for Atu5408 in Agrobacterium fabrum C58

Annotation: ABC transporter membrane spanning protein (amino acid)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 284 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 62 to 90 (29 residues), see Phobius details amino acids 97 to 126 (30 residues), see Phobius details amino acids 135 to 157 (23 residues), see Phobius details amino acids 242 to 265 (24 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 60 to 168 (109 residues), 60.2 bits, see alignment E=1.1e-20 PF00528: BPD_transp_1" amino acids 80 to 273 (194 residues), 75.1 bits, see alignment E=3.1e-25

Best Hits

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 100% identity to atu:Atu5408)

Predicted SEED Role

"Amino acid ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CL89 at UniProt or InterPro

Protein Sequence (284 amino acids)

>Atu5408 ABC transporter membrane spanning protein (amino acid) (Agrobacterium fabrum C58)
MALFAQPISMTVAPPNGKPVRWGQLATGSIAILMLALMTLAIGRNQSVQWSEIPRYMIDP
VILGGVILTLELTAGAMVAGIIIGCLVAVMATSQNIVLKAIAVAFVWWFRGVPLIVQIFF
WFNIALFVPEIGFGSWSVSVNDIVTPAFAGFLALGLHEAANMSEIIRSGLTAVDRGQREA
ASSLGLRPLQTLRTVVLPQAIRLIVPPTGNQAIGMLKASAIVSVIGMQDLLTQAQAIYAR
NFLVIELLCVASLWYLGITTIASIGQHYLERKLAPKGRSNSDKI