Protein Info for Atu5402 in Agrobacterium fabrum C58

Annotation: ABC transporter membrane spanning protein (sugar)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 transmembrane" amino acids 21 to 44 (24 residues), see Phobius details amino acids 76 to 99 (24 residues), see Phobius details amino acids 115 to 141 (27 residues), see Phobius details amino acids 161 to 186 (26 residues), see Phobius details amino acids 208 to 226 (19 residues), see Phobius details amino acids 267 to 289 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 91 to 290 (200 residues), 72.3 bits, see alignment E=2.2e-24

Best Hits

Swiss-Prot: 35% identical to Y4OQ_SINFN: Probable ABC transporter permease protein y4oQ (NGR_a02190) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: K02025, multiple sugar transport system permease protein (inferred from 100% identity to atu:Atu5402)

Predicted SEED Role

"Maltose/maltodextrin ABC transporter, permease protein MalF" in subsystem Maltose and Maltodextrin Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CL92 at UniProt or InterPro

Protein Sequence (297 amino acids)

>Atu5402 ABC transporter membrane spanning protein (sugar) (Agrobacterium fabrum C58)
MTASMPSRISGPGQTVLSFRWMMAPAVAFVGLMIVFPILYAIWLSLRENSLGMDDRFVGL
ANYVELLSDGEFHNAFILTWVLYGLALAMQMVIGTWLGFTLNRVRSARNLVRTAAIMPFM
MPPVVVGMMAIVILDPAVGVANWLLGQVGIGPSLWLADPKWVLLTVAAVDTWQWSPLIGL
LVLGGLQSLPTKVFEAAEIDGVIGWKRLVHITLPLLAPTLLSAAILRSVDLLRFFDVIYI
TTRGGPGNASTTLNIYAYQQGFEFSRFGYASAGMITLAAVVMVTVVAFSRLRQAVTW