Protein Info for Atu5382 in Agrobacterium fabrum C58

Annotation: HlyD family secretion protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 384 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 43 to 363 (321 residues), 232.1 bits, see alignment E=4.2e-73 PF25917: BSH_RND" amino acids 73 to 207 (135 residues), 29 bits, see alignment E=1.5e-10 PF25954: Beta-barrel_RND_2" amino acids 215 to 287 (73 residues), 46.5 bits, see alignment E=7.2e-16 PF25967: RND-MFP_C" amino acids 295 to 352 (58 residues), 27.4 bits, see alignment E=5.2e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu5382)

Predicted SEED Role

"RND efflux membrane fusion protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CLA4 at UniProt or InterPro

Protein Sequence (384 amino acids)

>Atu5382 HlyD family secretion protein (Agrobacterium fabrum C58)
MSSFRFVTATTVLKIAVVAGALSLLASCSEEKKAEAPDVVRPVKVAEIGAPDEGRKLIYS
GAVKARTEMNLGFHVSGKITERLVNVGDHVSPGAVLARLDPVDYKLAVTRAEADLSSARK
QVEITDLAYRRAQTLAAQNATSQSALEQASLSRDQAVSSRQSAESALEQARNQVAYSDLK
SDQKGIVTTVSADVGQVVSAGTPVVTVAVDGEKEVQIAVPEMDVSHFQPGKQVSASFWAA
NTIVLTGKVREVAQSADPQSRTFSVRVSLPEDQRVLLGMTATIEAKADNAVPAFSVPLAA
LGEKDGKKVVWVVDRQKGTVSSRPVEVVDFSDDGARISKGLSTGVLVVSAGTQFMREDMK
VRLPETVTSRFGSVNSLTTASVVP