Protein Info for Atu5375 in Agrobacterium fabrum C58

Annotation: two component sensor kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 441 TIGR00229: PAS domain S-box protein" amino acids 116 to 236 (121 residues), 106 bits, see alignment E=7.3e-35 PF00989: PAS" amino acids 118 to 228 (111 residues), 76.3 bits, see alignment E=6.5e-25 PF13188: PAS_8" amino acids 118 to 170 (53 residues), 25.4 bits, see alignment 3.6e-09 PF08448: PAS_4" amino acids 123 to 233 (111 residues), 47.9 bits, see alignment E=5e-16 PF13426: PAS_9" amino acids 128 to 230 (103 residues), 62.8 bits, see alignment E=1.1e-20 PF08447: PAS_3" amino acids 140 to 222 (83 residues), 31.1 bits, see alignment E=8e-11 PF07568: HisKA_2" amino acids 244 to 290 (47 residues), 27.1 bits, see alignment 1.3e-09 PF07536: HWE_HK" amino acids 244 to 332 (89 residues), 51.3 bits, see alignment E=5.8e-17

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu5375)

Predicted SEED Role

"Response sensor protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7D386 at UniProt or InterPro

Protein Sequence (441 amino acids)

>Atu5375 two component sensor kinase (Agrobacterium fabrum C58)
MRQHPIVMSRIFGNLDRFEAFAALLDNRQSSPMMSYCDDRECDDCAPSPQLLRSGQNIIS
SSLLGLLRACQQTFQHSTSTHEMEEYSHADDGATNEARLQRRLTQLKGAQPGYEAAAFLA
AIVESSDDAIISKSLQGIITTWNLSAERLFGYSADEAVGRPITMLIPEDRLDEEPAILAR
INAGERVDHFETVRRRKDGTLIDISLTISPIRAGDGTIIGASKIARDISERKRAAEHQDM
LLREMHHRVKNLFTITGSIITLAARTAQTPAELADGMKNRLIALSHAHQLTLPSFSGGES
PSERSTTLFNLLSNLLSPFADKDAGRWHLHGEDPHISAERVTSLALLFHEYATNAVKYSA
LSVADGRLDVTLTPGPDCFEIAWLESNARTTAAGKTKEADFGTTLENMLVRTLNAQVSRD
WQRQGLLIRLTLPRNVFSLPS