Protein Info for Atu5372 in Agrobacterium fabrum C58

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 411 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 34 to 55 (22 residues), see Phobius details amino acids 61 to 78 (18 residues), see Phobius details amino acids 88 to 105 (18 residues), see Phobius details amino acids 117 to 136 (20 residues), see Phobius details amino acids 145 to 166 (22 residues), see Phobius details amino acids 186 to 207 (22 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 215 to 376 (162 residues), 136.2 bits, see alignment E=4.5e-44 PF00990: GGDEF" amino acids 217 to 372 (156 residues), 135.6 bits, see alignment E=1.3e-43 PF22335: Cas10-Cmr2_palm2" amino acids 286 to 374 (89 residues), 29.8 bits, see alignment E=5.9e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu5372)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CLA8 at UniProt or InterPro

Protein Sequence (411 amino acids)

>Atu5372 hypothetical protein (Agrobacterium fabrum C58)
MPVALLDWAVPVTILLSGLALIAMRYLGFATSRWGYALCCLSIGFALMLIETNYATPFKQ
IVEDNFIVASVILACRALNDRVQLNNNIAFDLTMLLTSTIMVAISRTMFDSARLETLFVQ
ACCAFVLWRGYIRFSILAATKSDKILSFTFLLLAMVLTGQCLLYIAASETERLSGAWRTS
VWGNLVQFTGLIGSITLVFSVVIATTYEAIEKYRRYANLDPLTNLLNRRGLDAVLASAQG
ERLKKPATAIILADIDHFKAINDRFGHSFGDLVIKRFGALVQSHTTTQGCVARLGGEEFA
VLLPDTCLDDAIAAAEKMRRSFAAERWPCDRKESEFTASFGVALVEDGEALSTAFERADQ
FLYAAKRMGRNRVAAAKHVWRETLDPSLQLGHDNVVYIDRVTNESTHRPGV