Protein Info for Atu5345 in Agrobacterium fabrum C58

Annotation: ABC transporter membrane spanning protein (oligopeptide)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 transmembrane" amino acids 12 to 38 (27 residues), see Phobius details amino acids 107 to 130 (24 residues), see Phobius details amino acids 142 to 165 (24 residues), see Phobius details amino acids 185 to 205 (21 residues), see Phobius details amino acids 247 to 271 (25 residues), see Phobius details amino acids 289 to 314 (26 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 15 to 84 (70 residues), 42.2 bits, see alignment E=8.5e-15 PF00528: BPD_transp_1" amino acids 121 to 319 (199 residues), 121.8 bits, see alignment E=2.8e-39

Best Hits

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 100% identity to atu:Atu5345)

Predicted SEED Role

"Nucleoside ABC transporter, permease protein 1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CLC0 at UniProt or InterPro

Protein Sequence (323 amino acids)

>Atu5345 ABC transporter membrane spanning protein (oligopeptide) (Agrobacterium fabrum C58)
MKSGRKHPIQRMVAVRLGLGLFTLLFISLLIFLAVGLLPGDIAQQVLGQSATPETVAAFR
RELGLDQPLSWRYLTWIGGILTGDFGHSLANGRPVAELLSARLGNTLFLAAYAAAIAIPL
AVLLGLLAAMWRGTWFDRVINVMTLSAISFPEFFVAYILMFWLSVHMGWFPSVADPGAAP
DLFDMLRRAFLPAITLVLVVTAHMMRMTRAAVLNVLAEPYVIMARLKGASRWRIITRHAL
PNALAPISNVIAINVAWLITGVVIVEVVFVYPGLGQLMVDSVTNRDMPVVQACALIFAAV
YILLNLLADVLAIATNPRLLHPR