Protein Info for Atu5269 in Agrobacterium fabrum C58

Annotation: permease component of C4 dicarboxylate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 490 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 27 to 44 (18 residues), see Phobius details amino acids 56 to 74 (19 residues), see Phobius details amino acids 94 to 124 (31 residues), see Phobius details amino acids 136 to 160 (25 residues), see Phobius details amino acids 175 to 196 (22 residues), see Phobius details amino acids 216 to 242 (27 residues), see Phobius details amino acids 248 to 264 (17 residues), see Phobius details amino acids 281 to 300 (20 residues), see Phobius details amino acids 320 to 337 (18 residues), see Phobius details amino acids 344 to 370 (27 residues), see Phobius details amino acids 376 to 392 (17 residues), see Phobius details amino acids 414 to 440 (27 residues), see Phobius details PF06808: DctM" amino acids 2 to 438 (437 residues), 327 bits, see alignment E=8.4e-102 TIGR00786: TRAP transporter, DctM subunit" amino acids 12 to 441 (430 residues), 318 bits, see alignment E=4.1e-99

Best Hits

KEGG orthology group: None (inferred from 100% identity to atu:Atu5269)

Predicted SEED Role

"TRAP dicarboxylate transporter, DctM subunit, unknown substrate 6"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CLG4 at UniProt or InterPro

Protein Sequence (490 amino acids)

>Atu5269 permease component of C4 dicarboxylate transporter (Agrobacterium fabrum C58)
MFAALIIVLLLGYPVAFALAFVGFFFGFIGIELGLLPATLFQAIPDRIFGQMSNETLLAI
PFFTFMGLILEKSGMAEDLLDTIGQLFGPVRGGIAFAVIFVGAILAATTGVVAASVISMG
LISLPIMLRYGYDRKIAAGTIAASGTLAQIIPPSLVLIVLADQLGRSVGDMYKGALIPGL
MLVGAYTLYIVVTSIISPAKVPALPSEARTLRGSKLLLKVITSLVPPLVLIFLVLGTIFL
GIATPTEGGAMGAVGALALALANRKLNLGLIQQSLYATAKLSSFVLLILLGARVFSLTFY
GVNGHVWVEHLMTSVPGGEIGFLIVANLLVFFLAFFLDYFELAFIIIPLLAPVADALGID
LIWFGVMLAVNMQTSFMHPPFGFSLFFLRSVAPTRAYRDRITGQTIQPITSSQIYLGAIP
YLFIQLAMVIIIIAFPGIVMHYKSGAKVADPSAVHINVPMPGAGTDADPFANPFLAPGNT
APSFGKPSTP