Protein Info for Atu5264 in Agrobacterium fabrum C58

Annotation: ABC transporter membrane spanning protein (sugar)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 362 transmembrane" amino acids 18 to 43 (26 residues), see Phobius details amino acids 135 to 164 (30 residues), see Phobius details amino acids 176 to 197 (22 residues), see Phobius details amino acids 205 to 217 (13 residues), see Phobius details amino acids 228 to 249 (22 residues), see Phobius details amino acids 281 to 304 (24 residues), see Phobius details amino acids 333 to 353 (21 residues), see Phobius details PF00528: BPD_transp_1" amino acids 156 to 356 (201 residues), 48.9 bits, see alignment E=3.4e-17

Best Hits

KEGG orthology group: K02025, multiple sugar transport system permease protein (inferred from 100% identity to atu:Atu5264)

Predicted SEED Role

"Multiple sugar ABC transporter, membrane-spanning permease protein MsmF" in subsystem Fructooligosaccharides(FOS) and Raffinose Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A9CLG8 at UniProt or InterPro

Protein Sequence (362 amino acids)

>Atu5264 ABC transporter membrane spanning protein (sugar) (Agrobacterium fabrum C58)
MAFFSSKEKLTRDGVTGWLMAAPAMVLIGLFLITPFLLGLGFSFTNQRLTSPNPTEFVGV
ENYTRLLGIGVLTLQPEKEADGSISRDADGSVSYPRIRNFTRNNPDYPHLEGMREYKSFN
WGEHQIIILARDVVFLTALVNTLSFVVVVAPVQAALALFLALLVNQKIPGVTIFRAIYFM
PVVLSVVVVALLWRFIYAADNGLLNSLLSYMSFGLFQPIDWLGRTDTALWAILVMSVWQG
VGFHMVIWLSGLQTISPDLYEAADIEGASRWQRFSMITWPLLRNTAVLIVIVITMQAFAL
FAQIDVMTKGGPRDSTQSIVYQAVERGYRQQDIAAGSAISVVLFLLVLCISLTQRYMTRE
KQ