Protein Info for Atu5263 in Agrobacterium fabrum C58

Annotation: ABC transporter membrane spanning protein (sugar)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 78 to 107 (30 residues), see Phobius details amino acids 114 to 136 (23 residues), see Phobius details amino acids 156 to 178 (23 residues), see Phobius details amino acids 199 to 223 (25 residues), see Phobius details amino acids 260 to 278 (19 residues), see Phobius details PF00528: BPD_transp_1" amino acids 94 to 283 (190 residues), 64.9 bits, see alignment E=4.1e-22

Best Hits

KEGG orthology group: K02026, multiple sugar transport system permease protein (inferred from 100% identity to atu:Atu5263)

Predicted SEED Role

"Glycerol-3-phosphate ABC transporter, permease protein UgpE (TC 3.A.1.1.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (TC 3.A.1.1.3)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7D3H6 at UniProt or InterPro

Protein Sequence (293 amino acids)

>Atu5263 ABC transporter membrane spanning protein (sugar) (Agrobacterium fabrum C58)
MMQAGQRKSLAFLIGNYVLMLAFAAIFILPLLFMGFSSLKPNDQLLSDATSIRAFLPVGY
LSLENYTAAFVRAPIATFIFNSVLVTVVTVFLALLFGSLAAFAFTFLNWRGKDVLFSIIL
ATLIIPFETIAVPLLLEVNNLPWIGSGGFTWGWLNSWHVQIIPWIADGLTIFLFVQYFKD
LPKELLEAARIDGASWLRIYTQVVMPLSGPVIATAAILKFLVMYSQQYLWPLLVTQSEAY
RPVMVGLQYFFQLNTPWGEVMAYLTIITLPVLIFYLCLQRLFISSIAASGIKG