Protein Info for Atu5254 in Agrobacterium fabrum C58

Annotation: ABC transporter membrane spanning protein (oligopeptide)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 91 to 111 (21 residues), see Phobius details amino acids 121 to 147 (27 residues), see Phobius details amino acids 178 to 197 (20 residues), see Phobius details amino acids 232 to 255 (24 residues), see Phobius details amino acids 280 to 302 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 103 to 310 (208 residues), 126.5 bits, see alignment E=1.1e-40

Best Hits

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 100% identity to atu:Atu5254)

Predicted SEED Role

"Dipeptide transport system permease protein DppB (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q7D3I5 at UniProt or InterPro

Protein Sequence (314 amino acids)

>Atu5254 ABC transporter membrane spanning protein (oligopeptide) (Agrobacterium fabrum C58)
MQAILVALAMALIVFVGLHLIGSPIETLLPPEATYDDRLRLIADLGLDRPLYEQFFLFLK
GLLQGNLGVSYVYKEPAVELILSRLPATLELAFAAVLLSLIVGVPLGLAAGWKPESPLAR
IIMIGSIFGFSLPIFWIAVLLIMIFSVQLGWLPSSGRGATEILFGIPWSFVTLDGLRHML
LPAISLSLFNISMVTRLTEAGVREAMSSEYVRFARAKGLSPKRILSVHVLKNVMIPVVTV
VGLDIGQTIAFSVVTETIFAWPGVGKIIIDSIAALDRPVIVAYLMLVVVMFVIINLVVDV
TYRLLDPRIRLQGE